Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig EPO protein

This Pig EPO protein spans the amino acid sequence from region 27-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPOErythropoietin

UniProt

P49157

Expression Region

27-194aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length protein of HIS and expression region is 27-194aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xenin 25
4031355.0500 0.5 mg

Xenin 25

Sign In for Pricing
View Details
Sox3 Rabbit Polyclonal Antibody
TA362996 100 µL

Sox3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2119612-01 0.1 mL

APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2119612-02 0.2 mL

APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2119612-03 0.5 mL

APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2119612-04 1 mL

APC-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details