Human CXCL10 protein
This Human CXCL10 protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CXCL10
UniProt
P02778
Expression Region
22-98aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
10.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N2302-02B 1 mg
NFkB, p65 (NF-kB, Nuclear Factor kappa B, MGC131774, NFKB3, Nuclear Factor NF-Kappa-B p65, Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B Cells, RelA, Transcription Factor p65, v-Rel Avian Reticuloendotheliosis Viral Oncogene Homolog A)
Sign In for Pricing
View Details 
MBS9336262-01 48 Well
Human Transmembrane protein 59-like, TMEM59L ELISA Kit
Sign In for Pricing
View Details MBS9336262-02 96 Well
Human Transmembrane protein 59-like, TMEM59L ELISA Kit
Sign In for Pricing
View Details MBS9336262-03 5x 96 Well
Human Transmembrane protein 59-like, TMEM59L ELISA Kit
Sign In for Pricing
View Details