Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli MitTx-alpha protein

This E.coli MitTx-alpha protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kunitz-type neurotoxin MitTx-alpha

UniProt

G9I929

Expression Region

25-84aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Micrurus tener tener (Texas coral snake)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH
OR1074003-01 25 mg

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH

Sign In for Pricing
View Details
Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH
OR1074003-02 50 mg

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH

Sign In for Pricing
View Details
Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH
OR1074003-03 100 mg

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH

Sign In for Pricing
View Details
Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH
OR1074003-04 250 mg

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH

Sign In for Pricing
View Details
Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH
OR1074003-05 1 g

Fmoc-L-Ser (ß-D-GlcNAc (Ac) 3) -OH

Sign In for Pricing
View Details
FASTKD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0759107 1.0 µg DNA

FASTKD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details