Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli alpha-trichosanthin protein

This E.coli alpha-trichosanthin protein spans the amino acid sequence from region 24-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosome-inactivating protein alpha-trichosanthin, Alpha-TCS, EC 3.2.2.22, rRNA N-glycosidase

UniProt

P09989

Expression Region

24-270aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- (2- Aminoethylamino) adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer, immobilized on agarose gel (Rp-8-AEA-cAMPS-Agarose)
A 007-60 6 mL

8- (2- Aminoethylamino) adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer, immobilized on agarose gel (Rp-8-AEA-cAMPS-Agarose)

Sign In for Pricing
View Details
(8-Carboxyoctyl)triphenylphosphonium Bromide
TRC-C178905-100MG 100 mg

(8-Carboxyoctyl)triphenylphosphonium Bromide

Sign In for Pricing
View Details
KCNH7 Polyclonal Antibody
A59510-020 20 µL

KCNH7 Polyclonal Antibody

Sign In for Pricing
View Details
Human CD205/LY75 Antibody , FITC
E55A06970 50 Tests

Human CD205/LY75 Antibody , FITC

Sign In for Pricing
View Details
Recombinant Thermotoga maritima ATP synthase subunit c (atpE), partial
MBS7102858 Inquire

Recombinant Thermotoga maritima ATP synthase subunit c (atpE), partial

Sign In for Pricing
View Details
Mannan Binding Lectin Recombinant Rabbit mAb
E43S45678 100 µL

Mannan Binding Lectin Recombinant Rabbit mAb

Sign In for Pricing
View Details