What is the catalog number for E.coli karasurin-C protein?

The catalog number for E.coli karasurin-C protein is orb246893.

What sizes are available for E.coli karasurin-C protein?

E.coli karasurin-C protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli karasurin-C protein come in?

E.coli karasurin-C protein is available in 3 different pack sizes.

Is E.coli karasurin-C protein in stock?

E.coli karasurin-C protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli karasurin-C protein

This E.coli karasurin-C protein spans the amino acid sequence from region 22-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosome-inactivating protein karasurin-C, EC 3.2.2.22, rRNA N-glycosidase) [Cleaved into, Ribosome-inactivating protein karasurin-A]

UniProt

P24478

Expression Region

22-270aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 22-270aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA