Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse TIMP1 protein

This Mouse TIMP1 protein spans the amino acid sequence from region 25-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Clgi protein, Collagenase inhibitor protein, Collagenase inhibitor, Human protein, EPA protein, Erythroid Potentiating Activity protein, Erythroid-potentiating activity protein, Fibroblast collagenase inhibitor protein, HCI protein, Human Collagenase Inhibitor protein, Metalloproteinase inhibitor 1 protein, Metalloproteinase inhibitor 1 precursor protein, TIMP 1 protein, TIMP protein, TIMP metallopeptidase inhibitor 1 protein, TIMP-1 protein, Timp1 protein, TIMP1 protein protein, Tissue Inhibitor of Metalloproteinase 1 protein, Tissue inhibitor of metalloproteinases 1 protein, Tissue inhibitor of metalloproteinases protein

UniProt

P12032

Expression Region

25-205aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 25-205aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody
abx001811-01 20 µL

Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody

Sign In for Pricing
View Details
Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody
abx001811-02 100 µL

Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody

Sign In for Pricing
View Details
Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody
abx001811-03 2x 100 µL

Rap Guanine Nucleotide Exchange Factor 3 (RAPGEF3) Antibody

Sign In for Pricing
View Details
LAL Antibody
N0409-01 50 µL

LAL Antibody

Sign In for Pricing
View Details
LAL Antibody
N0409-02 100 µL

LAL Antibody

Sign In for Pricing
View Details
LAL Antibody
N0409-03 200 µL

LAL Antibody

Sign In for Pricing
View Details