Human BTN3A1 protein
This Human BTN3A1 protein spans the amino acid sequence from region 30-254aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BTN3A1
UniProt
O00481
Expression Region
30-254aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of Extracellular of His-SUMO-tag and expression region is 30-254aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15374220 1 Vial
Lentiviral human PRR19 sgRNA gene knockout kit - Lentiviral human PRR19 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 
MBS1292927-01 0.02 mg (E-Coli)
Recombinant Aeropyrum pernix N-glycosylase/DNA lyase (APE_0710.1)
Sign In for Pricing
View Details MBS1292927-02 0.02 mg (Yeast)
Recombinant Aeropyrum pernix N-glycosylase/DNA lyase (APE_0710.1)
Sign In for Pricing
View Details MBS1292927-03 0.1 mg (E-Coli)
Recombinant Aeropyrum pernix N-glycosylase/DNA lyase (APE_0710.1)
Sign In for Pricing
View Details MBS1292927-04 0.1 mg (Yeast)
Recombinant Aeropyrum pernix N-glycosylase/DNA lyase (APE_0710.1)
Sign In for Pricing
View Details MBS1292927-05 0.02 mg (Baculovirus)
Recombinant Aeropyrum pernix N-glycosylase/DNA lyase (APE_0710.1)
Sign In for Pricing
View Details