Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTN3A1 protein

This Human BTN3A1 protein spans the amino acid sequence from region 30-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTN3A1

UniProt

O00481

Expression Region

30-254aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 30-254aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-1255b-5p miRNA Mimic
CMH0817-01 5 nmol

Hsa-miR-1255b-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-1255b-5p miRNA Mimic
CMH0817-02 10 nmol

Hsa-miR-1255b-5p miRNA Mimic

Sign In for Pricing
View Details
Human ACY3 Protein
orb423972-01 2 µg

Human ACY3 Protein

Sign In for Pricing
View Details
Human ACY3 Protein
orb423972-02 10 µg

Human ACY3 Protein

Sign In for Pricing
View Details
Human ACY3 Protein
orb423972-03 1 mg

Human ACY3 Protein

Sign In for Pricing
View Details
Recombinant Human Peroxidasin-like protein (PXDNL) , partial
MBS954457-01 0.05 mg (E-Coli)

Recombinant Human Peroxidasin-like protein (PXDNL) , partial

Sign In for Pricing
View Details