Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Pectate lyase 1 protein

This Yeast Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1

UniProt

Q96385

Expression Region

22-375aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Chamaecyparis obtusa (Hinoki false-cypress)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBRM1 Rabbit Polyclonal Antibody
orb629691-01 50 µg

PBRM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PBRM1 Rabbit Polyclonal Antibody
orb629691-02 100 µg

PBRM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Osmr Rat siRNA Oligo Duplex (Locus ID 310132)
SR501933 1 Kit

Osmr Rat siRNA Oligo Duplex (Locus ID 310132)

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-human CD23
GT11426 100 Tests

Brilliant Violet 421™ anti-human CD23

Sign In for Pricing
View Details
ILP2 (BIRC8) (NM_033341) Human Tagged Lenti ORF Clone
RC207245L1 10 µg

ILP2 (BIRC8) (NM_033341) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
α-Adaptin 1 Lentiviral Activation Particles (h)
sc-406383-LAC 200 µL

α-Adaptin 1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details