Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Pectate lyase 1 protein

This Yeast Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1

UniProt

Q96385

Expression Region

22-375aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Chamaecyparis obtusa (Hinoki false-cypress)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18986064 1.0 µg DNA

EEF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BTG1, ID (BTG1, Protein BTG1, B Cell translocation gene 1 protein) (Azide free) (HRP)
MBS6279191-01 0.2 mL

BTG1, ID (BTG1, Protein BTG1, B Cell translocation gene 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
BTG1, ID (BTG1, Protein BTG1, B Cell translocation gene 1 protein) (Azide free) (HRP)
MBS6279191-02 5x 0.2 mL

BTG1, ID (BTG1, Protein BTG1, B Cell translocation gene 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit
orb780185-01 48 Tests

Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details
Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit
orb780185-02 96 Tests

Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details
Chicken Cordon-bleu protein-like 1 (COBLL1) ELISA Kit
MBS7208918-01 48 Well

Chicken Cordon-bleu protein-like 1 (COBLL1) ELISA Kit

Sign In for Pricing
View Details