Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATG16L1 protein

This Human ATG16L1 protein spans the amino acid sequence from region 1-607aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATG16L1

UniProt

Q676U5

Expression Region

1-607aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Esophagus
CS709765 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
EWSR1 (NM_005243) Human Recombinant Protein
TP303709M 100 µg

EWSR1 (NM_005243) Human Recombinant Protein

Sign In for Pricing
View Details
FITC Conjugated Human CD33 Recombinant Rabbit Monoclonal Antibody [PSH04-96]
HA720197F 100 µL

FITC Conjugated Human CD33 Recombinant Rabbit Monoclonal Antibody [PSH04-96]

Sign In for Pricing
View Details
Phospho-RSK1 (S380) Recombinant Rabbit Monoclonal Antibody [SC05-32]
ET1610-28 100 µL

Phospho-RSK1 (S380) Recombinant Rabbit Monoclonal Antibody [SC05-32]

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), Biotin conjugate, 0.1mg/mL
BNCB3309-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Cys-C (Cystatin C) ELISA Kit
E-EL-R0304-01 24 Tests

Rat Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details