Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Nqo2 protein

This Rat Nqo2 protein spans the amino acid sequence from region 1-231aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nqo2

UniProt

Q6AY80

Expression Region

1-231aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD49d antibody
MO49DA(V25) 25 µg

CD49d antibody

Sign In for Pricing
View Details
TRNAG6 AAV Vector (Human) (CMV)
48066101 1 µg

TRNAG6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
LARP6 Blocking Peptide
33R-6082 100 ug

LARP6 Blocking Peptide

Sign In for Pricing
View Details
AK2 Antibody
PT-A00148-01 5 µg

AK2 Antibody

Sign In for Pricing
View Details
AK2 Antibody
PT-A00148-02 20 µg

AK2 Antibody

Sign In for Pricing
View Details
AK2 Antibody
PT-A00148-03 100 µg

AK2 Antibody

Sign In for Pricing
View Details