Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast stxB2 protein

This Yeast stxB2 protein spans the amino acid sequence from region 20-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB2

UniProt

P09386

Expression Region

20-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage 933W (Bacteriophage 933W)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2F2 Recombinant Protein
OPCA01635-20UG 20 µg

GTF2F2 Recombinant Protein

Sign In for Pricing
View Details
Rat Cdh5 ELISA KIT (1 x 96 wells)
EA102611 96 Well

Rat Cdh5 ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
LIMA1 Polyclonal Antibody
E44H10442 100 µL

LIMA1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Ephrin A Receptor 4/EphA4
CK51-50ug 50 µg

Recombinant Human Ephrin A Receptor 4/EphA4

Sign In for Pricing
View Details
Tmem134 ORF Vector (Rat) (pORF)
ORF077836 1.0 µg DNA

Tmem134 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Ttc25 shRNA (UAS) - Lentiviral mouse Ttc25 shRNA (UAS) (25)
GTR15281933 1 Vial

Lentiviral mouse Ttc25 shRNA (UAS) - Lentiviral mouse Ttc25 shRNA (UAS) (25)

Sign In for Pricing
View Details