Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast stxB2 protein

This Yeast stxB2 protein spans the amino acid sequence from region 20-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB2

UniProt

P09386

Expression Region

20-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage 933W (Bacteriophage 933W)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody
abx131361-01 100 µL

Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody

Sign In for Pricing
View Details
Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody
abx131361-02 200 µL

Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody

Sign In for Pricing
View Details
Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody
abx131361-03 1 mL

Nucleosome Assembly Protein 1 Like Protein 1 (NAP1L1) Antibody

Sign In for Pricing
View Details
CD79a (B-Cell Marker) Antibody
orb1713208 0.1 mL

CD79a (B-Cell Marker) Antibody

Sign In for Pricing
View Details
Zinc Finger And SCAN Domain Containing 16 (ZSCAN16) Antibody
abx030376-01 80 µL

Zinc Finger And SCAN Domain Containing 16 (ZSCAN16) Antibody

Sign In for Pricing
View Details
Zinc Finger And SCAN Domain Containing 16 (ZSCAN16) Antibody
abx030376-02 400 µL

Zinc Finger And SCAN Domain Containing 16 (ZSCAN16) Antibody

Sign In for Pricing
View Details