Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cssB protein

This E. coli cssB protein spans the amino acid sequence from region 22-167aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CssB

UniProt

P53510

Expression Region

22-167aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF3 Rabbit pAb
orb2708270-01 50 µL

ARF3 Rabbit pAb

Sign In for Pricing
View Details
ARF3 Rabbit pAb
orb2708270-02 100 µL

ARF3 Rabbit pAb

Sign In for Pricing
View Details
Threo Ifenprodil hemitartrate
orb1703978-01 25 mg

Threo Ifenprodil hemitartrate

Sign In for Pricing
View Details
Threo Ifenprodil hemitartrate
orb1703978-02 50 mg

Threo Ifenprodil hemitartrate

Sign In for Pricing
View Details
Threo Ifenprodil hemitartrate
orb1703978-03 100 mg

Threo Ifenprodil hemitartrate

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Ribonuclease H (rnhA)
MBS1082065-01 0.02 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides Ribonuclease H (rnhA)

Sign In for Pricing
View Details