Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast botF protein

This Yeast botF protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BotF

UniProt

P30996

Expression Region

1-436aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MXRA5 Human Gene Knockout Kit (CRISPR)
KN423347 1 Kit

MXRA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Unknown tissue
CS716654 5x 5 µm

Tissue FFPE Sections, Unknown tissue

Sign In for Pricing
View Details
Bottle-top Dispenser with 38, 45, 33mm adapter
LS-900 1 Dispenser

Bottle-top Dispenser with 38, 45, 33mm adapter

Sign In for Pricing
View Details
CCR5 (Ab-336) Antibody
8B0061-AAT 50 µg

CCR5 (Ab-336) Antibody

Sign In for Pricing
View Details
Human FOXD4L2 (FOXD4L3) activation kit by CRISPRa
GA117296 1 Kit

Human FOXD4L2 (FOXD4L3) activation kit by CRISPRa

Sign In for Pricing
View Details
Usp24 Mouse Gene Knockout Kit (CRISPR)
KN518782 1 Kit

Usp24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details