Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast neurotoxin type E protein

This Yeast neurotoxin type E protein spans the amino acid sequence from region 2-422aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Botulinum neurotoxin type E, BoNT/E, Bontoxilysin-E) [Cleaved into, Botulinum neurotoxin E light chain, LC, EC 3.4.24.69), Botulinum neurotoxin E heavy chain, HC) ]

UniProt

P30995

Expression Region

2-422aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium butyricum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GFPT1 Antibody, Rabbit Polyclonal
MBS8104782-01 0.1 mL

Anti-GFPT1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-GFPT1 Antibody, Rabbit Polyclonal
MBS8104782-02 5x 0.1 mL

Anti-GFPT1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
CLEC2B discontinued
387597 200 µL

CLEC2B discontinued

Sign In for Pricing
View Details
Vilastobart Biosimilar (Monoclonal, IgG1)
A138251 100 µL

Vilastobart Biosimilar (Monoclonal, IgG1)

Sign In for Pricing
View Details
(R) -4-Benzyl Albuterol
166155 10 mg

(R) -4-Benzyl Albuterol

Sign In for Pricing
View Details
EFCAB14 (EF-Hand Domain-Containing Protein KIAA0494)
479924 100 µL

EFCAB14 (EF-Hand Domain-Containing Protein KIAA0494)

Sign In for Pricing
View Details