Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aroD protein

This Yeast aroD protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AroD

UniProt

P24670

Expression Region

1-252aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc16a ORF Vector (Rat) (pORF)
ORF069991 1.0 µg DNA

Lrrc16a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CN Filters Type 11303 1.2um 47mm
FIL1352 100 / PCK

CN Filters Type 11303 1.2um 47mm

Sign In for Pricing
View Details
Ino80b 3'UTR Luciferase Stable Cell Line
TU110128 1.0 mL

Ino80b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Susd2 3'UTR Luciferase Stable Cell Line
TU221422 1.0 mL

Susd2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse CCL25
MBS7608827-01 0.05 mg

Recombinant Mouse CCL25

Sign In for Pricing
View Details
Recombinant Mouse CCL25
MBS7608827-02 0.2 mg

Recombinant Mouse CCL25

Sign In for Pricing
View Details