Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast aroD protein

This Yeast aroD protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AroD

UniProt

P24670

Expression Region

1-252aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkyl (C12-C14) glycidyl ether
FA40324-01 0.5 Kg

Alkyl (C12-C14) glycidyl ether

Sign In for Pricing
View Details
Alkyl (C12-C14) glycidyl ether
FA40324-02 1 Kg

Alkyl (C12-C14) glycidyl ether

Sign In for Pricing
View Details
Alkyl (C12-C14) glycidyl ether
FA40324-03 2 Kg

Alkyl (C12-C14) glycidyl ether

Sign In for Pricing
View Details
Alkyl (C12-C14) glycidyl ether
FA40324-04 5 Kg

Alkyl (C12-C14) glycidyl ether

Sign In for Pricing
View Details
Alkyl (C12-C14) glycidyl ether
FA40324-05 10 Kg

Alkyl (C12-C14) glycidyl ether

Sign In for Pricing
View Details
Levosimendan Impurity 101
RM-L052901-01 10 mg

Levosimendan Impurity 101

Sign In for Pricing
View Details