Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast fbpB protein

This Yeast fbpB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FbpB

UniProt

P9WQP0

Expression Region

41-325aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf86 Antibody
MBS9523410-01 0.04 mL

C1orf86 Antibody

Sign In for Pricing
View Details
C1orf86 Antibody
MBS9523410-02 0.1 mL

C1orf86 Antibody

Sign In for Pricing
View Details
C1orf86 Antibody
MBS9523410-03 0.2 mL

C1orf86 Antibody

Sign In for Pricing
View Details
C1orf86 Antibody
MBS9523410-04 5x 0.2 mL

C1orf86 Antibody

Sign In for Pricing
View Details
Pig Interferon Alpha-1 (IFNA1) Protein
abx657072-01 50 µg

Pig Interferon Alpha-1 (IFNA1) Protein

Sign In for Pricing
View Details
Pig Interferon Alpha-1 (IFNA1) Protein
abx657072-02 100 µg

Pig Interferon Alpha-1 (IFNA1) Protein

Sign In for Pricing
View Details