Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Gellan lyase protein

This Yeast Gellan lyase protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gellan lyase, EC 4.2.2.25, Fragments

UniProt

P85513

Expression Region

1-204aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Geobacillus stearothermophilus (Bacillus stearothermophilus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF594 conjugate, 0.1mg/mL
BNC940502-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Contactin 3/CNTN3 Protein (708 Asp/Asn, Fc Tag)
PKSH031803 100 µg

Recombinant Human Contactin 3/CNTN3 Protein (708 Asp/Asn, Fc Tag)

Sign In for Pricing
View Details
D-Lyxonic Acid, Potassium Salt
TRC-L489950-2.5G 2.5 g

D-Lyxonic Acid, Potassium Salt

Sign In for Pricing
View Details
RPS9 Antibody
8C14127-AAT 50 µg

RPS9 Antibody

Sign In for Pricing
View Details
FOLR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E10]
TA811544AM 100 µL

FOLR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E10]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]
E-AB-F1413J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]

Sign In for Pricing
View Details