Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast stxB protein

This Yeast stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Eotaxin 1 Antibody Pair Set
E-KAB-0598 50 µL & 100 µg

Mouse Eotaxin 1 Antibody Pair Set

Sign In for Pricing
View Details
NHLH1 (NM_005598) Human Over-expression Lysate
LC401716 20 µg

NHLH1 (NM_005598) Human Over-expression Lysate

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), Biotin conjugate, 0.1mg/mL
BNCB0416-100 1x 100 µL

Fascin-1 (FSCN1/416), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163H-01 20 Tests

PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163H-02 100 Tests

PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details