Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast stxB protein

This Yeast stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR51B5 activation kit by CRISPRa
GA116965 1 Kit

Human OR51B5 activation kit by CRISPRa

Sign In for Pricing
View Details
MPEG1 (NM_001039396) Human Over-expression Lysate
LY422045 100 µg

MPEG1 (NM_001039396) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate
LC400369 20 µg

Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF640R conjugate, 0.1mg/mL
BNC401634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-[(4-Fluorophenyl)carbonyl]benzonitrile
TRC-F621315-50MG 50 mg

4-[(4-Fluorophenyl)carbonyl]benzonitrile

Sign In for Pricing
View Details
Complement C3 (C3) Rabbit Monoclonal Antibody [Clone ID: R06-2C2]
TA421495 100 µL

Complement C3 (C3) Rabbit Monoclonal Antibody [Clone ID: R06-2C2]

Sign In for Pricing
View Details