Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast stxB protein

This Yeast stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

StxB

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ANG2 Protein (His Tag)
PDMH100179-01 20 µg

Recombinant Human ANG2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ANG2 Protein (His Tag)
PDMH100179-02 100 µg

Recombinant Human ANG2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ANG2 Protein (His Tag)
PDMH100179-03 500 µg

Recombinant Human ANG2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ANG2 Protein (His Tag)
PDMH100179-04 1 mg

Recombinant Human ANG2 Protein (His Tag)

Sign In for Pricing
View Details
Tide Quencher™ 3 phosphoramidite [TQ3 phosphoramidite]
2228-AAT 100 µmole

Tide Quencher™ 3 phosphoramidite [TQ3 phosphoramidite]

Sign In for Pricing
View Details
DGKK Antibody
8C11181-AAT 50 µg

DGKK Antibody

Sign In for Pricing
View Details