Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Vegfc protein

This Mouse Vegfc protein spans the amino acid sequence from region 108-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vegfc

UniProt

P97953

Expression Region

108-223aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufb9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3849105 3x 1.0 µg

Ndufb9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral human SPANXN5 shRNA (UAS) - Lentiviral human SPANXN5 shRNA (UAS) (25)
GTR15324992 1 Vial

Lentiviral human SPANXN5 shRNA (UAS) - Lentiviral human SPANXN5 shRNA (UAS) (25)

Sign In for Pricing
View Details
Guinea Pig anti-Cubilin antibody ELISA Kit
MBS7276739-01 48 Well

Guinea Pig anti-Cubilin antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Cubilin antibody ELISA Kit
MBS7276739-02 96 Well

Guinea Pig anti-Cubilin antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Cubilin antibody ELISA Kit
MBS7276739-03 5x 96 Well

Guinea Pig anti-Cubilin antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Cubilin antibody ELISA Kit
MBS7276739-04 10x 96 Well

Guinea Pig anti-Cubilin antibody ELISA Kit

Sign In for Pricing
View Details