Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Vegfc protein

This Mouse Vegfc protein spans the amino acid sequence from region 108-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vegfc

UniProt

P97953

Expression Region

108-223aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP4 Peptide (AAP52460)
AAP52460-100UG 100 µg

GBP4 Peptide (AAP52460)

Sign In for Pricing
View Details
IL1F10 Rabbit Polyclonal Antibody
orb402583 100 µg

IL1F10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rbx2 Lentiviral Activation Particles (m2)
sc-422690-LAC-2 200 µL

Rbx2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
mmu-miR-7647-5p Primers
MPM02109 150 µL / 10 µM

mmu-miR-7647-5p Primers

Sign In for Pricing
View Details
OX40 Protein, Rhesus, Recombinant (His Tag)
PK54101M2-01 50 µg

OX40 Protein, Rhesus, Recombinant (His Tag)

Sign In for Pricing
View Details
OX40 Protein, Rhesus, Recombinant (His Tag)
PK54101M2-02 500 µg

OX40 Protein, Rhesus, Recombinant (His Tag)

Sign In for Pricing
View Details