Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat S100A8 protein

This Rat S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAGA protein, Calgranulin-A protein, CFAG protein, CGLA protein, Chemotactic cytokine CP-10 protein, CP-10 protein, Cystic fibrosis antigen protein, L1Ag protein, Leukocyte L1 complex light chain protein, MA387 protein, Migration inhibitory factor-related protein 8 protein, Myeloid-related protein 8 protein, Neutrophil cytosolic 7 kDa protein protein, NIF protein, Pro-inflammatory S100 cytokine protein, Protein S100-A8 protein, S100 calcium binding protein A8 (calgranulin A) protein, S100 calcium binding protein A8 protein, S100A8 protein, S100A8/S100A9 complex, included protein, Urinary stone protein band A protein, MRP8 protein, MRP-8 protein, 60B8Ag protein

UniProt

P50115

Expression Region

2-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO39 Antibody - N-terminal region : FITC (ARP53143_P050-FITC)
ARP53143_P050-FITC 100 µL

FBXO39 Antibody - N-terminal region : FITC (ARP53143_P050-FITC)

Sign In for Pricing
View Details
Zirconium (IV) butoxide solution
sc-258364 100 mL

Zirconium (IV) butoxide solution

Sign In for Pricing
View Details
TRIM73 Human shRNA Lentiviral Particle (Locus ID 375593)
TL307907V 500 µL Each

TRIM73 Human shRNA Lentiviral Particle (Locus ID 375593)

Sign In for Pricing
View Details
STAT5 (Signal Transducer and Activator of Transcription 5A, STAT5A, STAT5, Signal Transducer and Activator of Transcription 5B, STAT5B) discontinued
226080-01 50 µL

STAT5 (Signal Transducer and Activator of Transcription 5A, STAT5A, STAT5, Signal Transducer and Activator of Transcription 5B, STAT5B) discontinued

Sign In for Pricing
View Details
STAT5 (Signal Transducer and Activator of Transcription 5A, STAT5A, STAT5, Signal Transducer and Activator of Transcription 5B, STAT5B) discontinued
226080-02 100 µL

STAT5 (Signal Transducer and Activator of Transcription 5A, STAT5A, STAT5, Signal Transducer and Activator of Transcription 5B, STAT5B) discontinued

Sign In for Pricing
View Details
Goat vasoactive intestinal peptide (VIP) Elisa Kit
EK771056 96 Well

Goat vasoactive intestinal peptide (VIP) Elisa Kit

Sign In for Pricing
View Details