Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast PTPRZ1 protein

This Yeast PTPRZ1 protein spans the amino acid sequence from region 36-300aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTPRZ1

UniProt

P23471

Expression Region

36-300aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM145 Recombinant Protein (Human)
RP101990 100 µg

TMEM145 Recombinant Protein (Human)

Sign In for Pricing
View Details
MAN2C1 Knockout Raji Polyclonal Cells
ARG1427 1 Million

MAN2C1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Human SNX24 qPCR Primer Pair
QH38985S 200 Tests

Human SNX24 qPCR Primer Pair

Sign In for Pricing
View Details
LOC100365556 3'UTR GFP Stable Cell Line
TU259558 1.0 mL

LOC100365556 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
OR11J6P Protein Vector (Human) (pPB-N-His)
PV106067 500 ng

OR11J6P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DHCR24 Peptide
orb2015340 100 µg

DHCR24 Peptide

Sign In for Pricing
View Details