Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Prss1 protein

This Rat Prss1 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prss1

UniProt

P00762

Expression Region

24-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPH1 Polyclonal Antibody
A51825-020 20 µL

HNRNPH1 Polyclonal Antibody

Sign In for Pricing
View Details
Zebrafish HOXA3/3A Rabbit Polyclonal Antibody (HRP)
orb3130522 100 µg

Zebrafish HOXA3/3A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Tnni3 (NM_009406) Mouse Recombinant Protein
PM48248M5 20 µg

Tnni3 (NM_009406) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human LAPTM5 shRNA (UAS) - Lentiviral human LAPTM5 shRNA (UAS) (25)
GTR15316688 1 Vial

Lentiviral human LAPTM5 shRNA (UAS) - Lentiviral human LAPTM5 shRNA (UAS) (25)

Sign In for Pricing
View Details
ATF-2 (phosphorylated Ser472)
307051 100 µL

ATF-2 (phosphorylated Ser472)

Sign In for Pricing
View Details
Mouse Monoclonal Monkeypox Virus A29L Antibody (0027) [DyLight 680]
NBP3-18270FR 0.1 mL

Mouse Monoclonal Monkeypox Virus A29L Antibody (0027) [DyLight 680]

Sign In for Pricing
View Details