Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast plp protein

This Yeast plp protein spans the amino acid sequence from region 150-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plp

UniProt

P79826

Expression Region

150-218aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC46 Polyclonal Antibody
orb1414341 100 µL

CDC46 Polyclonal Antibody

Sign In for Pricing
View Details
Trioctylmethylphosphonium methylcarbonate, 30% in MeOH
IN-0031-SG-0250 250 g

Trioctylmethylphosphonium methylcarbonate, 30% in MeOH

Sign In for Pricing
View Details
Dopamine-PEG-N3 (MW 10000)
HY-W1123941H 1 Each

Dopamine-PEG-N3 (MW 10000)

Sign In for Pricing
View Details
COL27A1 Antibody
orb1561759-01 50 µL

COL27A1 Antibody

Sign In for Pricing
View Details
COL27A1 Antibody
orb1561759-02 100 µL

COL27A1 Antibody

Sign In for Pricing
View Details
COL27A1 Antibody
orb1561759-03 200 µL

COL27A1 Antibody

Sign In for Pricing
View Details