Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast plp protein

This Yeast plp protein spans the amino acid sequence from region 150-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plp

UniProt

P79826

Expression Region

150-218aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1G2 (Casein Kinase I Isoform Gamma-2, CKI-Gamma 2, CK1G2)
406304-01 50 µL

CSNK1G2 (Casein Kinase I Isoform Gamma-2, CKI-Gamma 2, CK1G2)

Sign In for Pricing
View Details
CSNK1G2 (Casein Kinase I Isoform Gamma-2, CKI-Gamma 2, CK1G2)
406304-02 100 µL

CSNK1G2 (Casein Kinase I Isoform Gamma-2, CKI-Gamma 2, CK1G2)

Sign In for Pricing
View Details
Havcr1 3'UTR Luciferase Stable Cell Line
TU205650 1.0 mL

Havcr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
hsa-miR-6718-5p miRNA Mimic
MCH03395 2x 2.5 nmol

hsa-miR-6718-5p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Transcriptional repressor NrdR (nrdR)
MBS1420455-01 0.02 mg (E-Coli)

Recombinant Thermotoga maritima Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Transcriptional repressor NrdR (nrdR)
MBS1420455-02 0.1 mg (E-Coli)

Recombinant Thermotoga maritima Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details