Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast plp protein

This Yeast plp protein spans the amino acid sequence from region 150-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plp

UniProt

P79826

Expression Region

150-218aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLN8 Knockout HEK293T cell line
GTR15412261 1 Vial

Human CLN8 Knockout HEK293T cell line

Sign In for Pricing
View Details
Mouse Vasodilator-stimulated phosphoprotein ELISA Kit
MBS289428-01 48 Well

Mouse Vasodilator-stimulated phosphoprotein ELISA Kit

Sign In for Pricing
View Details
Mouse Vasodilator-stimulated phosphoprotein ELISA Kit
MBS289428-02 96 Well

Mouse Vasodilator-stimulated phosphoprotein ELISA Kit

Sign In for Pricing
View Details
Mouse Vasodilator-stimulated phosphoprotein ELISA Kit
MBS289428-03 5x 96 Well

Mouse Vasodilator-stimulated phosphoprotein ELISA Kit

Sign In for Pricing
View Details
Mouse Vasodilator-stimulated phosphoprotein ELISA Kit
MBS289428-04 10x 96 Well

Mouse Vasodilator-stimulated phosphoprotein ELISA Kit

Sign In for Pricing
View Details
ZNF289 (ADP-ribosylation Factor GTPase Activating Protein 2)
588838 50 µg

ZNF289 (ADP-ribosylation Factor GTPase Activating Protein 2)

Sign In for Pricing
View Details