Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast MMP9 protein

This Yeast MMP9 protein spans the amino acid sequence from region 107-704aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP9

UniProt

O18733

Expression Region

107-704aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FQTFEGDLKWHHNDITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGPEADIIIQFGVREHGDGYPFDGKNGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTHFGNADGAPCHFPFTFEGRSYSACTTDGRSDDTPWCSTTADYDTDRRFGFCPSEKLYAQDGNGDGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCSTTADYDQDKLYGFCPTRVDSAVTGGNSAGEPCVFPFIFLGKQYSTCTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYSFTEGPPLHEDDVRGIQHLYGPRPEPEPQPPTAPPTAPPTVCATGPPTTRPSERPTAGPTGPPAAGPTGPPTAGPSEAPTVPVDPAEDICKVNIFDAIAEIRNYLHFFKEGKYWRFSKGKGRRVQGPFLSPSTWPALPRKLDSAFEDGLTKKTFFFSGRQVWVYTGTSVVGPRRLDKLGLGPEVTQVTGALPQGGGKVLLFSRQRFWSFDVKTQTVDPRSAGSVEQMYPGVPLNTHDIFQYQEKAYFCQDRFYWRVNSRNEVNQVDEVGYVTFDILQCPED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAPLN1 Rabbit Polyclonal Antibody (HRP)
orb2122877 100 µL

HAPLN1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DHRS9 3'UTR Luciferase Stable Cell Line
TU005984 1.0 mL

DHRS9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CLN8 Antibody (C-term) Blocking Peptide
MBS9223706-01 0.5 mg

CLN8 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
CLN8 Antibody (C-term) Blocking Peptide
MBS9223706-02 5x 0.5 mg

CLN8 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Rabbit anti-TSHZ1 Antibody
MBS4509558-01 0.05 mL

Rabbit anti-TSHZ1 Antibody

Sign In for Pricing
View Details
Rabbit anti-TSHZ1 Antibody
MBS4509558-02 0.1 mL

Rabbit anti-TSHZ1 Antibody

Sign In for Pricing
View Details