Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast MMP9 protein

This Yeast MMP9 protein spans the amino acid sequence from region 107-704aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP9

UniProt

O18733

Expression Region

107-704aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FQTFEGDLKWHHNDITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGPEADIIIQFGVREHGDGYPFDGKNGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTHFGNADGAPCHFPFTFEGRSYSACTTDGRSDDTPWCSTTADYDTDRRFGFCPSEKLYAQDGNGDGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCSTTADYDQDKLYGFCPTRVDSAVTGGNSAGEPCVFPFIFLGKQYSTCTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYSFTEGPPLHEDDVRGIQHLYGPRPEPEPQPPTAPPTAPPTVCATGPPTTRPSERPTAGPTGPPAAGPTGPPTAGPSEAPTVPVDPAEDICKVNIFDAIAEIRNYLHFFKEGKYWRFSKGKGRRVQGPFLSPSTWPALPRKLDSAFEDGLTKKTFFFSGRQVWVYTGTSVVGPRRLDKLGLGPEVTQVTGALPQGGGKVLLFSRQRFWSFDVKTQTVDPRSAGSVEQMYPGVPLNTHDIFQYQEKAYFCQDRFYWRVNSRNEVNQVDEVGYVTFDILQCPED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RX7 Rabbit Polyclonal Antibody
TA379552 100 µL

P2RX7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-APOE monoclonal antibody, clone TD1647
CABT-L692 100 ul

Rabbit Anti-APOE monoclonal antibody, clone TD1647

Sign In for Pricing
View Details
Cdk11b (NM_007661) Mouse Tagged ORF Clone Lentiviral Particle
MR220708L4V 200 µL

Cdk11b (NM_007661) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Atinumab (Anti-RTN4 / NOGO)
C00770-1mg*25 25x 1mg

Atinumab (Anti-RTN4 / NOGO)

Sign In for Pricing
View Details
BTBD19 (NM_001136537) Human Over-expression Lysate
LS149478 100 µg

BTBD19 (NM_001136537) Human Over-expression Lysate

Sign In for Pricing
View Details
HMHA1 Rabbit Polyclonal Antibody
orb666909-01 30 µL

HMHA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details