Human CD41 protein
This Human CD41 protein spans the amino acid sequence from region 639-887aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Antigen CD41 protein, CD 41 protein, CD41 protein, CD-41 protein, CD41 antigen protein, CD41a protein, CD41b protein, GP2b protein, GPalpha IIb protein, GPalphaIIb protein, GPIIb protein, GT protein, Gta protein, HPA 3 protein, HPA3 protein, Integrin alpha 2b protein, Integrin alpha IIb protein, Integrin alpha IIb precursor protein, Integrin alpha-IIb light chain protein, ITGA 2B protein, ITGA2B protein, ITGAB protein, Platelet membrane glycoprotein IIb protein, Platelet specific antigen bak protein
UniProt
P08514
Expression Region
639-887aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog