Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifnar2 protein

This Mouse Ifnar2 protein spans the amino acid sequence from region 22-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ifnar2

UniProt

O35664

Expression Region

22-242aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC10 Protein Vector (Human) (pPM-C-His)
PV060676 500 ng

ABCC10 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RBL2 Protein Vector (Mouse) (pPM-C-His)
PV222793 500 ng

RBL2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Ly6g Rabbit Monoclonal Antibody
M30404-1-40μl 40 µL

Anti-Ly6g Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CRISP2 Rabbit Polyclonal Antibody (HRP)
orb471564 100 µL

CRISP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Chlamydia pneumonia IgM ELISA
CP095M 1 Each

Chlamydia pneumonia IgM ELISA

Sign In for Pricing
View Details
Fbxo17 3'UTR GFP Stable Cell Line
TU254497 1.0 mL

Fbxo17 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details