Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifnar2 protein

This Mouse Ifnar2 protein spans the amino acid sequence from region 22-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ifnar2

UniProt

O35664

Expression Region

22-242aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (MaxLight 405)
MBS6384548-01 0.1 mL

Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (MaxLight 405)

Sign In for Pricing
View Details
Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (MaxLight 405)
MBS6384548-02 5x 0.1 mL

Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (MaxLight 405)

Sign In for Pricing
View Details
ALDH6A1 Rabbit Polyclonal Antibody (Biotin)
orb2116612 100 µL

ALDH6A1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
hsa-miR-4790-3p miRNA Inhibitor
MIH02711 2x 5.0 nmol

hsa-miR-4790-3p miRNA Inhibitor

Sign In for Pricing
View Details
EBM Recombinant Protein (Human)
RP055977 100 µg

EBM Recombinant Protein (Human)

Sign In for Pricing
View Details
1-Ethylimidazolium trifluoromethanesulfonate
IL-0271-HP-0500 500 g

1-Ethylimidazolium trifluoromethanesulfonate

Sign In for Pricing
View Details