Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hmox1 protein

This Mouse Hmox1 protein spans the amino acid sequence from region 1-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hmox1

UniProt

P14901

Expression Region

1-289aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TTC1 siRNA
abx938425-01 15 nmol

Mouse TTC1 siRNA

Sign In for Pricing
View Details
Mouse TTC1 siRNA
abx938425-02 30 nmol

Mouse TTC1 siRNA

Sign In for Pricing
View Details
MRP-S18A Lentiviral Activation Particles (m2)
sc-427101-LAC-2 200 µL

MRP-S18A Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
VPC 23019
MBS3614035-01 10 mg

VPC 23019

Sign In for Pricing
View Details
VPC 23019
MBS3614035-02 25 mg

VPC 23019

Sign In for Pricing
View Details
VPC 23019
MBS3614035-03 50 mg

VPC 23019

Sign In for Pricing
View Details