Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cenpa protein

This Mouse Cenpa protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cenpa

UniProt

O35216

Expression Region

1-134aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine NUP160 ELISA Kit
ECN0059 96 Tests

Canine NUP160 ELISA Kit

Sign In for Pricing
View Details
C10orf68 (CCDC7) (NM_145023) Human Over-expression Lysate
LH14160V 100 µg

C10orf68 (CCDC7) (NM_145023) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Apolipoprotein L6, APOL6 ELISA KIT
ELI-34854h 96 Tests

Human Apolipoprotein L6, APOL6 ELISA KIT

Sign In for Pricing
View Details
Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC
MBS1491036-01 0.05 mg

Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC
MBS1491036-02 0.1 mg

Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC
MBS1491036-03 5x 0.1 mg

Rabbit anti-human Thioredoxin-like protein 1 polyclonal Antibody, FITC

Sign In for Pricing
View Details