Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cenpa protein

This Mouse Cenpa protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cenpa

UniProt

O35216

Expression Region

1-134aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orlistat Impurity 59
RM-O121959-01 10 mg

Orlistat Impurity 59

Sign In for Pricing
View Details
Orlistat Impurity 59
RM-O121959-02 25 mg

Orlistat Impurity 59

Sign In for Pricing
View Details
Orlistat Impurity 59
RM-O121959-03 50 mg

Orlistat Impurity 59

Sign In for Pricing
View Details
Orlistat Impurity 59
RM-O121959-04 100 mg

Orlistat Impurity 59

Sign In for Pricing
View Details
CHST13 Antibody
A17345-100UL 100 µL

CHST13 Antibody

Sign In for Pricing
View Details
TUBB2B 293 Cell Lysate
403746 0.1 mg

TUBB2B 293 Cell Lysate

Sign In for Pricing
View Details