Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD81 protein

This Human CD81 protein spans the amino acid sequence from region 113-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD81

UniProt

P60033

Expression Region

113-201aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP4, ID (TRIP4, Activating signal cointegrator 1, Thyroid receptor-interacting protein 4) (MaxLight 550) discontinued
043270-ML550 100 µL

TRIP4, ID (TRIP4, Activating signal cointegrator 1, Thyroid receptor-interacting protein 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Oit3 shRNA (UAS) - Lentiviral mouse Oit3 shRNA (UAS, iRFP) plasmid
GTR15298231 1 Vial

Lentiviral mouse Oit3 shRNA (UAS) - Lentiviral mouse Oit3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NPTX1 Antibody
E30AC1959 100 µL

NPTX1 Antibody

Sign In for Pricing
View Details
Hemoglobin Beta (HBb) Monoclonal Antibody
CAU30247-01 100 µL

Hemoglobin Beta (HBb) Monoclonal Antibody

Sign In for Pricing
View Details
Hemoglobin Beta (HBb) Monoclonal Antibody
CAU30247-02 200 µL

Hemoglobin Beta (HBb) Monoclonal Antibody

Sign In for Pricing
View Details
Hemoglobin Beta (HBb) Monoclonal Antibody
CAU30247-03 1 mL

Hemoglobin Beta (HBb) Monoclonal Antibody

Sign In for Pricing
View Details