Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Batf3 protein

This Rat Batf3 protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Batf3

UniProt

P97876

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lck Rabbit mAb
orb1564675-01 20 ul

Lck Rabbit mAb

Sign In for Pricing
View Details
Lck Rabbit mAb
orb1564675-02 50 µL

Lck Rabbit mAb

Sign In for Pricing
View Details
Lck Rabbit mAb
orb1564675-03 100 µL

Lck Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to C1QA
MBS8528589-01 0.1 mL

Mouse Monoclonal Antibody to C1QA

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to C1QA
MBS8528589-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to C1QA

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to C1QA
MBS8528589-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to C1QA

Sign In for Pricing
View Details