Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASAH2B protein

This Human ASAH2B protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASAH2B

UniProt

P0C7U1

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAIL-R1 polyclonal antibody
BML-SA225-0100 100 µg

TRAIL-R1 polyclonal antibody

Sign In for Pricing
View Details
BTN2A1 Rabbit pAb
E45R18041N-100 100 µL

BTN2A1 Rabbit pAb

Sign In for Pricing
View Details
NMT2 Mouse Monoclonal Antibody [Clone 1B4]
E45M12150V-2 50 µL

NMT2 Mouse Monoclonal Antibody [Clone 1B4]

Sign In for Pricing
View Details
Odin (F-9) FITC
sc-398547 FITC 200 µg/mL

Odin (F-9) FITC

Sign In for Pricing
View Details
SMAD6 (Mothers Against decapentaplegic homolog 6, MAD Homolog 6, mothers against DPP Homolog 6, SMAD Family Member 6, SMAD 6, hSMAD6, MADH6) (AP) discontinued
133544-AP 100 µL

SMAD6 (Mothers Against decapentaplegic homolog 6, MAD Homolog 6, mothers against DPP Homolog 6, SMAD Family Member 6, SMAD 6, hSMAD6, MADH6) (AP) discontinued

Sign In for Pricing
View Details
PROTAC BTK Degrader-11
HY-159947 1 Each

PROTAC BTK Degrader-11

Sign In for Pricing
View Details