Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aquaporin 4 Proteins

This Aquaporin 4 Proteins spans the amino acid sequence from region 253-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-AQP 4 antibody, anti-AQP-4 antibody, anti-AQP4 antibody, anti-Aquaporin type 4 antibody, anti-AQP4_HUMAN antibody, anti-Aquaporin-4 antibody, anti-Aquaporin4 antibody, anti-Aquaporin 4 antibody

UniProt

P55087

Expression Region

253-323aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Despropionyl Elsulfavirine-13C6
TRC-D976751-25MG 25 mg

Despropionyl Elsulfavirine-13C6

Sign In for Pricing
View Details
Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate
LY429349 100 µg

Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Ethoxybenzimidohydrazide Hydrochloride
TRC-E891315-250MG 250 mg

2-Ethoxybenzimidohydrazide Hydrochloride

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
E-AB-40520-01 25 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
E-AB-40520-02 100 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
3-(Phenoxy-13C6)benzoic Acid
TRC-P228012-5MG 5 mg

3-(Phenoxy-13C6)benzoic Acid

Sign In for Pricing
View Details