Aquaporin 4 Proteins
This Aquaporin 4 Proteins spans the amino acid sequence from region 253-323aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Anti-AQP 4 antibody, anti-AQP-4 antibody, anti-AQP4 antibody, anti-Aquaporin type 4 antibody, anti-AQP4_HUMAN antibody, anti-Aquaporin-4 antibody, anti-Aquaporin4 antibody, anti-Aquaporin 4 antibody
UniProt
P55087
Expression Region
253-323aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Kidney & Urological Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
10 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#20877-50uL 1x 50 µL
CF®505 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
Sign In for Pricing
View Details 
BNC041633-100 1x 100 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942597-100 1x 100 µL
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![KIF25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea18017/imageurl/ta505427bm.webp)
TA505427BM 100 µL
KIF25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H1]
Sign In for Pricing
View Details