Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Annexin A5 protein

This Yeast Annexin A5 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Annexin A5, Annexin V, Annexin-5

UniProt

P70075

Expression Region

1-323aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cynops pyrrhogaster (Japanese fire-bellied newt)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dctn6 Rat shRNA Plasmid (Locus ID 290798)
TL704677 1 Kit

Dctn6 Rat shRNA Plasmid (Locus ID 290798)

Sign In for Pricing
View Details
Human PTP synthase,PTPS ELISA KIT
ELI-22172h 96 Tests

Human PTP synthase,PTPS ELISA KIT

Sign In for Pricing
View Details
GOLPH2 antibody
22764 100 µL

GOLPH2 antibody

Sign In for Pricing
View Details
Aurora kinase ligand-1
orb3136578-01 10 mg

Aurora kinase ligand-1

Sign In for Pricing
View Details
Aurora kinase ligand-1
orb3136578-02 50 mg

Aurora kinase ligand-1

Sign In for Pricing
View Details
Antho-rpamide II
T25092-01 100 mg

Antho-rpamide II

Sign In for Pricing
View Details