What is the catalog number for Yeast Annexin A5 protein?

The catalog number for Yeast Annexin A5 protein is orb246721.

What sizes are available for Yeast Annexin A5 protein?

Yeast Annexin A5 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Yeast Annexin A5 protein come in?

Yeast Annexin A5 protein is available in 3 different pack sizes.

Is Yeast Annexin A5 protein in stock?

Yeast Annexin A5 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Yeast Annexin A5 protein

This Yeast Annexin A5 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Annexin A5, Annexin V, Annexin-5

UniProt

P70075

Expression Region

1-323aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cynops pyrrhogaster (Japanese fire-bellied newt)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE