Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli D-LDH protein

This E.coli D-LDH protein spans the amino acid sequence from region 1-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

D-LDH

UniProt

P51011

Expression Region

1-331aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Leuconostoc mesenteroides subsp. cremoris

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIFAYGIRDDEKPSLEEWKAANPEIEVDYTQELLTPETAKLAEGSDSAVVYQQLDYTRETLTALANVGVTNLSLRNVGTDNIDFDAAREFNFNISNVPVYSPNAIAEHSMLQLSRLLRRTKALDAKIAKRDLRWAPTTGREMRMQTVGVIGTGHIGRVAINILKGFGAKVIAYDKYPNAELQAEGLYVDTLDELYAQADAISLYVPGVPENHHLINADAIAKMKDGVVIMNAARGNLMDIDAIIDGLNSGKISDFGMDVYENEVACSMKIGLVKNSPDAKIADLIARENVMITPHTAFYTTKAVLEMVHQSFDAAVAFAKGEKPAIAVEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)
MBS7012552-01 0.02 mg

Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)
MBS7012552-02 0.1 mg

Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)
MBS7012552-03 5x 0.1 mg

Recombinant Azotobacter vinelandii Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
CNOT4 Protein Vector (Mouse) (pPB-C-His)
PV166762 500 ng

CNOT4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Thyroglobulin (TG)
MBS2041319-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Thyroglobulin (TG)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Thyroglobulin (TG)
MBS2041319-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Thyroglobulin (TG)

Sign In for Pricing
View Details