Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli pstS1 protein

This E.coli pstS1 protein spans the amino acid sequence from region 24-373aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PstS1 phoS1

UniProt

P9WGU0

Expression Region

24-373aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku-80 Polyclonal Antibody
E44H14757 100 µL

Ku-80 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL36 Recombinant Protein (Mouse)
RP151547 100 µg

MRPL36 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human ZBED3 protein
orb1463835-01 50 µg

Human ZBED3 protein

Sign In for Pricing
View Details
Human ZBED3 protein
orb1463835-02 100 µg

Human ZBED3 protein

Sign In for Pricing
View Details
Human ZBED3 protein
orb1463835-03 200 µg

Human ZBED3 protein

Sign In for Pricing
View Details
Human ZBED3 protein
orb1463835-04 1 mg

Human ZBED3 protein

Sign In for Pricing
View Details