Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli pstS1 protein

This E.coli pstS1 protein spans the amino acid sequence from region 24-373aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PstS1 phoS1

UniProt

P9WGU0

Expression Region

24-373aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (SPM130) : m-IgG Fc BP-HRP Bundle
sc-536867 1 Kit

CD68 (SPM130) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Phospho-Cannabinoid Receptor I (Ser316) Antibody
orb1733106 100 µL

Phospho-Cannabinoid Receptor I (Ser316) Antibody

Sign In for Pricing
View Details
FLJ31438 CRISPR/Cas9 KO Plasmid (h)
sc-416565 20 µg

FLJ31438 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Primary Rabbit Annulus Fibrosus Cells (AFC)
TRV-0018325 5x 10^5 Cells

Primary Rabbit Annulus Fibrosus Cells (AFC)

Sign In for Pricing
View Details
MYF5 ORF Vector (Human) (pORF)
ORF025765 1.0 µg DNA

MYF5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cbll1 Antibody - C-terminal region : FITC (ARP33600_P050-FITC)
ARP33600_P050-FITC 100 µL

Cbll1 Antibody - C-terminal region : FITC (ARP33600_P050-FITC)

Sign In for Pricing
View Details